lipolysis comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-04-19. Where a claim depends on a specific study, the study is described rather than over-claimed.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
AOD-9604 has been investigated primarily as a potential treatment for obesity and related metabolic conditions. Early laboratory work examined its effects on fat cells, and later studies moved into animal models and human clinical trials. Some trials reportedly reached Phase II, but the program did not lead to an approved medicine. Published summaries often note that weight-loss results were modest or inconsistent. The full trial data are not all publicly available in detail.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Peptide fragment | Corresponds to hGH residues 176-191 |
| Common synonyms | AOD9604, hGH 176-191 | Also written as AOD-9604 |
| Typical form | Lyophilized powder | Often supplied in sealed vials |
| Solubility | Water-soluble | Dissolves in aqueous buffers |
| Regulatory status | Not approved as drug | Banned in sport; varies by country |
Early interest in AOD-9604 centered on whether a fragment of human growth hormone could influence fat metabolism without the broader effects of the full hormone. Cell and animal studies reported changes in fat storage and breakdown. Human trials followed, but the results were not strong enough to secure regulatory approval. The compound remains available for laboratory research, and its clinical potential is still described as uncertain. Studies continue to examine its activity and safety profile.
AOD-9604 is a synthetic peptide that corresponds to a short section of human growth hormone. It is commonly identified as hGH fragment 176-191 because its sequence matches residues at the C-terminal end of the hormone. The molecule contains sixteen amino acids and is made by solid-phase peptide synthesis. Researchers study it for metabolic effects rather than for the growth-promoting actions associated with full human growth hormone. Its small size distinguishes it from the complete 191-amino-acid hormone.
Several names appear in scientific and commercial settings. AOD9604 and AOD-9604 are development codes used interchangeably, while hGH fragment 176-191 describes the same region. The peptide includes a disulfide bond between two cysteine residues, which helps shape its three-dimensional structure. Different suppliers may provide acetate or other salt forms, and purity can vary. These differences matter because analytical tests and biological assays can respond to the specific form being studied.
Stability of AOD-9604 depends on storage conditions. Lyophilized powder is generally more stable than reconstituted solution. Recommended storage is typically at -20°C or lower, protected from light and moisture. Repeated freeze-thaw cycles can cause aggregation or degradation. In solution, the peptide may be susceptible to hydrolysis or oxidation, so aliquoting and cold storage are common practices. Researchers often add stabilizers such as mannitol or trehalose during lyophilization to improve shelf life.
Quality control for AOD-9604 involves verifying identity, purity, and concentration. Suppliers may provide a certificate of analysis listing HPLC purity and mass spectrometry data. Independent verification is advised because peptide products can vary in quality. Researchers should check for counterions, residual solvents, and microbial contamination. Proper documentation supports reproducibility and safety in laboratory studies. When sourcing, institutions often require third-party testing and detailed chain-of-custody records. These steps help ensure that experimental results are attributable to the peptide rather than impurities.
Analytical characterization of AOD-9604 typically employs reversed-phase high-performance liquid chromatography (RP-HPLC) to assess purity and identity. Mass spectrometry provides confirmation of molecular mass, while amino acid analysis can verify composition. These methods are standard for peptide research chemicals. Because the peptide lacks a distinct chromophore, detection often relies on ultraviolet absorbance at 214 nm or mass spectrometric response. Laboratories may also use capillary electrophoresis for separation. For example, size-exclusion chromatography can detect aggregates.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
Clinical development of AOD-9604 included trials in people with obesity. Reports from early-phase and mid-phase studies described modest or inconsistent changes in body weight. A phase IIb program did not meet its primary endpoint, and the compound was not approved for medical use. Differences in formulation, delivery route, and participant characteristics may explain some of the variation. Later investigations explored whether the peptide might have effects in other tissues, including cartilage.
Regulatory treatment of AOD-9604 is shaped by its classification as a peptide hormone. The World Anti-Doping Agency lists it as a prohibited substance, and many national anti-doping organizations adopt that list. It does not hold approval as a prescription medicine in the United States, the European Union, or other major markets. Products sold online are frequently labeled for research use only and may not undergo independent quality testing. Import and possession rules differ by country, so legal status depends on local law.
Proposed mechanisms for AOD-9604 focus on fat cells. Laboratory studies suggest the peptide can increase lipolysis, the breakdown of stored fat, and reduce lipogenesis, the formation of new fat. Unlike full human growth hormone, it does not appear to stimulate substantial IGF-1 production in the studies reported so far. Some evidence points to beta-adrenergic signaling, but the precise receptor targets and downstream pathways remain unresolved. The fragment is not thought to act through the classical growth hormone receptor.
== Antiquity == The first attempts at general anesthesia were probably herbal remedies administered in prehistory. Alcohol is the oldest known sedative; it was used in ancient Mesopotamia thousands of years ago.
Retrieved 26 September 2021 – via Google Books. Jones, Colin (1994). The Cambridge Illustrated History of France. Cambridge University Press. ISBN 978-0-521-66992-4. Jones, Maldwyn Allen (1992). Boorstin, Daniel J. (ed.). American Immigration. University of Chicago Press. ISBN 978-0-226-40633-6. Kagan, Frederick (2007). The End of the Old Order: Napoleon and Europe, 1801–1805. Hachette Books. ISBN 978-0-306-81645-1. Keeling, Drew (1999). "The Transportation Revolution and Transatlantic Migration". Research in Economic History. 19. Keeling, Drew (1 January 2007). "Transport Capacity Management and Transatlantic Migration, 1900–1914". Research in Economic History. 25. Emerald Group Publishing Limited: 225–283. doi:10.1016/s0363-3268(07)25005-0. ISBN 978-0-7623-1370-9.{{cite journal}}: CS1 maint: periodical has ISBN (link) Keen, Benjamin; Haynes, Keith (2012). A History of Latin America. Cengage Learning. ISBN 978-1-133-70932-9. Kennedy, Paul M. (1989). The Rise and Fall of the Great Powers: Economic Change and Military Conflict from 1500 to 2000. Vintage Books. ISBN 978-0-679-72019-5. Knight, Roger (2013). Britain Against Napoleon: The Organization of Victory, 1793–1815. Penguin UK. ISBN 978-0-14-197702-7. Leggiere, Michael V. (2014). Blücher: Scourge of Napoleon. University of Oklahoma Press. ISBN 978-0-8061-4567-9. Malia, Martin Edward (2006). History's Locomotives: Revolutions and the Making of the Modern World. Yale University Press. ISBN 978-0-300-12690-7. McConachy, Bruce (2001). "The Roots of Artillery Doctrine: Napoleonic Artillery Tactics Reconsidered".
=== Psychosocial === Psychosocial interventions are used as an adjunct to pharmaceutical treatment and can be classified within behavior-, emotion-, cognition- or stimulation-oriented approaches. Behavioral interventions attempt to identify and reduce the antecedents and consequences of problem behaviors. This approach has not reported success in improving overall functioning, but can help to reduce some specific problem behaviors, such as incontinence. There is a lack of high quality data on the effectiveness of these techniques in other behavior problems such as wandering. Music therapy is effective in reducing behavioral and psychological symptoms. Emotion-oriented interventions include reminiscence therapy, validation therapy, supportive psychotherapy, sensory integration, also called snoezelen, and simulated presence therapy. A Cochrane review has found no evidence that this is effective. Reminiscence therapy (RT) involves the discussion of past experiences, individually or in groups, many times with the aid of photographs, household items, music and sound recordings, or other familiar items from the past. A 2018 review of the effectiveness of RT found that effects were inconsistent, small in size, and of doubtful clinical significance, and varied by setting. Simulated presence therapy (SPT) is based on attachment theories and involves playing a recording with the voices of the closest relatives of the person with AD. There is partial evidence indicating that SPT may reduce challenging behaviors.
Occurs at rest or minimal exertion and usually lasts more than 20 minutes (if nitroglycerin is not administered) Being severe (at least Canadian Cardiovascular Society Classification 3) and of new onset (i.e. within 1 month) Occurs with a crescendo pattern (brought on by less activity, more severe, more prolonged or increased frequency than previously). Fifty percent of people with unstable angina will have evidence of necrosis of the heart's muscular cells based on elevated cardiac serum markers such as creatine kinase isoenzyme (CK)-MB and troponin T or troponin I, and thus have a diagnosis of non-ST elevation myocardial infarction.
=== Areolar tissue === Areolar tissue ( or ) is a common type of loose connective tissue (and the most widely distributed type of connective tissue in vertebrates). It is so-named because its fibers are far enough apart to leave ample open space for interstitial fluid in between (areola is Latin for a "little open space"). It is strong enough to bind different tissue types together, yet soft enough to provide flexibility and cushioning. It exhibits interlacing, loosely organized fibers, abundant blood vessels, and significant empty space filled with interstitial fluid. Many adjacent epithelial tissues (which are avascular) get their nutrients from the interstitial fluid of areolar tissue; the lamina propria is areolar in many body locations. Its fibers run in random directions and are mostly collagenous, but elastic and reticular fibers are also present. Areolar tissue is highly variable in appearance. In many serous membranes, it appears as a loose arrangement of collagenous and elastic fibers, scattered cells of various types; abundant ground substance; numerous blood vessels. In the skin and mucous membranes, it is more compact and sometimes difficult to distinguish from dense irregular connective tissue.
Sources: en.wikipedia.org
side chain A chemical substituent group that is attached to the core part or "backbone" of a larger molecule, especially an oligomeric or polymeric hydrocarbon chain that branches off of the longer primary chain of a macromolecule. The term is most commonly encountered in biochemistry and organic chemistry.
== Multi-substrate reactions == Multi-substrate reactions follow complex rate equations that describe how the substrates bind and in what sequence. The analysis of these reactions is much simpler if the concentration of substrate A is kept constant and substrate B varied. Under these conditions, the enzyme behaves just like a single-substrate enzyme, and a plot of v by [S] gives apparent KM and Vmax constants for substrate B. If a set of these measurements is performed at different fixed concentrations of A, these data can be used to work out what the mechanism of the reaction is. For an enzyme that takes two substrates A and B and turns them into two products P and Q, there are two types of mechanism: ternary complex and substituted-enzyme mechanisms. Ternary-complex mechanisms
Also in 1973, the "Percy Amendment" of the Foreign Assistance Act required U.S. development assistance to integrate women into its programs, leading to USAID's creation of its Women in Development (WID) office in 1974. The Helms Amendment of 1973 banned use of U.S. government funds for abortion as a method of family planning, which effectively required USAID to eliminate all support for abortion. A further amendment of the Foreign Assistance Act in 1974 prohibited assistance for police, thus ending USAID's involvement in Public Safety programs in Latin America, which in the 1960s were, along with the Vietnam War, part of the U.S. government's anti-Communist strategy. The reforms also ended the practice of the 1960s and 1970s in which many USAID officers in Latin America and Southeast Asia had worked in joint offices led by State Department diplomats or in units with U.S. military personnel. The Basic Human Needs reforms largely cut off USAID's assistance to higher education. A large part of that assistance had gone to agricultural universities in hungry developing countries, as illustrated by a 1974 book by a University of Illinois professor, Hadley Read, describing USAID-supported U.S. land-grant universities' work in building India's agricultural universities. Read's book inspired an Illinois Member of Congress concerned with famine prevention, Paul Findley, to draft a bill authorizing more support for programs like the ones Read described. In a legislative process involving USAID staff, the association of state universities and land-grant colleges (NASULGC), and Sen.
This can be used as the basis for biosensors. Once assembled, the two separate DNA strands can be ligated into a single strand. Unmodified aptamers are cleared rapidly from the bloodstream, with a half-life of seconds to hours. This is mainly due to nuclease degradation, which physically destroys the aptamers, as well as clearance by the kidneys, a result of the aptamer's low molecular weight and size. Several modifications, such as 2'-fluorine-substituted pyrimidines and polyethylene glycol (PEG) linkage, permit a serum half-life of days to weeks. PEGylation can add sufficient mass and size to prevent clearance by the kidneys in vivo. Unmodified aptamers can treat coagulation disorders. The problem of clearance and nuclease digestion is diminished when they are applied to the eye, where there is a lower concentration of nuclease and the rate of clearance is lower. Rapid clearance from serum can also be useful in some applications, such as in vivo diagnostic imaging. In a study on aptamers designed to bind with proteins associated with Ebola infection, a comparison was made among three aptamers isolated for their ability to bind the target protein EBOV sGP. Although these aptamers vary in both sequence and structure, they exhibit remarkably similar relative affinities for sGP from EBOV and SUDV, as well as EBOV GP1.2. Notably, these aptamers demonstrated a high degree of specificity for the GP gene products.
=== Fibroblast growth factor === fibroblast growth factor (FGF-21) has been recently characterized as a potent metabolic regulator. Systemic administration of FGF-21 reduced plasma glucose and triglycerides to near normal levels in genetically compromised diabetic rodents. FGF21 can function as a crucial regulator mediating beneficial metabolic effects of therapeutic agents such as metformin, glucagon/glucagonlike peptide1analogues, thiazolidinedione, sirtuin 1 activators, and lipoic acid. A study showed that when fibroblast growth factor-21 administered daily for 6 weeks to diabetic rhesus monkeys, it caused a dramatic decline in fasting plasma glucose, fructosamine, triglycerides, insulin and glucagon. In a significant point during the study, FGF-21 administration also led to significant improvements in lipoprotein profiles and a beneficial changes in the circulating levels of several cardiovascular risk markers. And the induction of a small but significant weight loss. These data support the development of FGF-21 for the treatment of diabetes and other metabolic diseases.
Sources: en.wikipedia.org
== Treatment == Some strains of H. influenzae produce beta-lactamases, and are also able to modify its penicillin-binding proteins, so the bacteria have gained resistance to the penicillin family of antibiotics. In severe cases, cefotaxime and ceftriaxone delivered directly into the bloodstream are the elected antibiotics, and, for the less severe cases, an association of ampicillin and sulbactam, cephalosporins of the second and third generation, or fluoroquinolones are preferred. (Fluoroquinolone-resistant strains of H. influenzae have been observed). Macrolides and fluoroquinolones have activity against non-typeable H. influenzae and could be used in patients with a history of allergy to beta-lactam antibiotics. However, macrolide resistance has also been observed.
=== Antibacterial spectrum === Colistin has been effective in treating infections caused by Pseudomonas, Escherichia, and Klebsiella species. The following represents minimum inhibitory concentration (MIC) susceptibility data for a few medically significant microorganisms:
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
left splicing junction Also donor splicing junction or donor splicing site. The boundary between the left end (by convention, the 5' end) of an intron and the right (3') end of an adjacent exon in a pre-mRNA transcript.
Sources: en.wikipedia.org
AOD-9604 is a synthetic peptide fragment of human growth hormone, corresponding to amino acids 176-191. It is studied for potential effects on fat metabolism, but it is not approved as a drug in most countries. Its exact mechanism remains under investigation.
No, it is a small fragment of the full growth hormone protein. It does not appear to stimulate growth or increase growth hormone levels in the same way. Its actions are thought to be more limited to metabolic pathways.
Regulatory status varies. It is not approved for medical use in the United States or many other countries. It is banned in sport by WADA, and its sale as a supplement or research chemical may be subject to legal restrictions.
No major medicines regulator appears to have approved AOD-9604 for human therapeutic use. It has been studied in clinical trials, but those programs did not result in a marketed drug.